PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v3336090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 261aa    MW: 28095.6 Da    PI: 7.7327
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v3336090.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.48.7e-32113169158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy +Il+RRq+Rak+e ekkl +k rkpylheSRh+hAlrR+RgsgGrF
  Lj2g3v3336090.1 113 QEPVYVNAKQYLGILRRRQARAKAELEKKL-IKVRKPYLHESRHQHALRRARGSGGRF 169
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.0E-35111172IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.126112172IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.6E-27114169IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-23115137IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860117137IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.1E-23146169IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSGANASNSS SLDCANSDSS ETGEDQSLYN NGVNEEDDAT KESQPTGSNG PGDQGIQHAS  60
SASTQTPQAC ASNPYQDPYY GGMMAAYAHQ QLGYGPFIAM PHPRMALPLE MAQEPVYVNA  120
KQYLGILRRR QARAKAELEK KLIKVRKPYL HESRHQHALR RARGSGGRFA KKTEADTSGG  180
PIPPSQSISS SGSEPLPSDS AETWNSPSVQ QATTGGSKVH ERFQEHSYAS GGSGSYHNHN  240
GSQRPSSFCS EHTSQRRLAI Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19113177266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182702e-87JQ918270.1 Medicago truncatula nuclear transcription factor Y subunit A5 (NF-YA5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014626518.11e-106PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_003551355.11e-106PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ9LXV59e-66NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0B2REF61e-106A0A0B2REF6_GLYSO; Nuclear transcription factor Y subunit A-1
STRINGGLYMA18G07890.21e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.48e-59nuclear factor Y, subunit A1